| ID | DRAMP02793 |
|---|---|
| Sequence | MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF |
| Length | 44 |
| Name | Antibacterial protein1 (Gonococcal growth inhibitor I) |
| Source | Staphylococcus haemolyticus |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Gonococci |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P11697 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 3138972 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF |
| Molecular Weight | 4523.234 |
| Grand Average of Hydropathy | 0.461 |
| Isoelectric Point | 5.971 |
| Charge at pH 7.4 | -0.722 |
| Secondary Structure | Helix: 0.318, Turn: 0.227, Sheet: 0.273 |
| Instability Index | -7.152 |
| Aromaticity | 0.068 |
