| ID | DRAMP02977 |
|---|---|
| Sequence | SVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK |
| Length | 37 |
| Name | pBD-1 (porcine beta-defensin 1; pigs, mammals, animals) |
| Source | Sus scrofa (Pig) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Staphylococcus aureus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17168333 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | SVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK |
| Molecular Weight | 3999.995 |
| Grand Average of Hydropathy | -0.327 |
| Isoelectric Point | 9.819 |
| Charge at pH 7.4 | 8.089 |
| Secondary Structure | Helix: 0.135, Turn: 0.270, Sheet: 0.135 |
| Instability Index | 95.97 |
| Aromaticity | 0 |