| ID | DRAMP03135 |
|---|---|
| Sequence | ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN |
| Length | 40 |
| Name | Defensin-B (AaeDefB; Insects, animals) |
| Source | Aedes aegypti (Yellowfever mosquito) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | P81602, Q71U14, Q71U15 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7633471 |
Physicochemical Properties
| Residues | 40 |
|---|---|
| Sequence | ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN |
| Molecular Weight | 4078.599 |
| Grand Average of Hydropathy | 0.077 |
| Isoelectric Point | 8.354 |
| Charge at pH 7.4 | 1.493 |
| Secondary Structure | Helix: 0.200, Turn: 0.300, Sheet: 0.175 |
| Instability Index | 24.608 |
| Aromaticity | 0.05 |