| ID | DRAMP03367 |
|---|---|
| Sequence | AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK |
| Length | 51 |
| Name | Beta-defensin 2 (BD-2, mBD-2; Defensin, beta 2; Defb2; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P82020 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9923615 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK |
| Molecular Weight | 5546.371 |
| Grand Average of Hydropathy | -0.439 |
| Isoelectric Point | 8.632 |
| Charge at pH 7.4 | 2.52 |
| Secondary Structure | Helix: 0.196, Turn: 0.314, Sheet: 0.196 |
| Instability Index | 48.114 |
| Aromaticity | 0.078 |
