| ID | DRAMP03397 |
|---|---|
| Sequence | FLENQDCSKHRHCRMKCKANEYAVRYCEDWTICCRVKKKESKKKKMW |
| Length | 47 |
| Name | Beta-defensin 43 (BD-43, mBD-43; Defensin, beta 43; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KM9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 15489334 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | FLENQDCSKHRHCRMKCKANEYAVRYCEDWTICCRVKKKESKKKKMW |
| Molecular Weight | 5870.906 |
| Grand Average of Hydropathy | -1.27 |
| Isoelectric Point | 9.441 |
| Charge at pH 7.4 | 7.459 |
| Secondary Structure | Helix: 0.191, Turn: 0.085, Sheet: 0.191 |
| Instability Index | 31.134 |
| Aromaticity | 0.106 |
