| ID | DRAMP03626 |
|---|---|
| Sequence | FISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW |
| Length | 48 |
| Name | Beta-defensin 131 (Beta-defensin 31, DEFB-31; Defensin, beta 131; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P59861 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12600824, 15815621 |
Physicochemical Properties
| Residues | 48 |
|---|---|
| Sequence | FISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW |
| Molecular Weight | 5701.494 |
| Grand Average of Hydropathy | -0.458 |
| Isoelectric Point | 6.062 |
| Charge at pH 7.4 | -1.53 |
| Secondary Structure | Helix: 0.292, Turn: 0.146, Sheet: 0.187 |
| Instability Index | 33.967 |
| Aromaticity | 0.125 |