Basic Information
| ID | DRAMP03409 |
| Sequence | CFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ |
| Length | 31 |
| Name | Neutrophil defensin 2 (HANP-2; alpha-defensin; Rodents, mammals, animals) |
| Source | Mesocricetus auratus (Golden hamster) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus, Streptococcus pyogenes, Enterococcus faecalis;##Gram-negative bacteria: Escherichia coli, Salmonella serotype krefeld, Klebsiella oxytoca, Pseudomonas aeruginosa.##Fungi: Candida albicans, Cryptococcus neoformans. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Cyclization(Cys1 and Cys29). |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot |
P81466 |
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 8890190 |
|---|