| ID | DRAMP03494 |
|---|---|
| Sequence | WKPFKKIEKAVRRVRDGVAKAGPAVAVVGQAT |
| Length | 32 |
| Name | Cecropin (Insects, animals) |
| Source | Oiketicus kirbyi (Bagworm moth) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P83420 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | WKPFKKIEKAVRRVRDGVAKAGPAVAVVGQAT |
| Molecular Weight | 3434.047 |
| Grand Average of Hydropathy | -0.194 |
| Isoelectric Point | 11.122 |
| Charge at pH 7.4 | 5.546 |
| Secondary Structure | Helix: 0.281, Turn: 0.156, Sheet: 0.219 |
| Instability Index | 40.997 |
| Aromaticity | 0.062 |