| ID | DRAMP03730 |
|---|---|
| Sequence | KWLNEKSIQNKIDEKIGKNFLGGMAKAVVHKLAKNEFMCMANMDPTGSCETHCQKASGEKGYCHGTKCKCGVPLSY |
| Length | 76 |
| Name | Opiscorpine-2 (Arthropods, animals) |
| Source | Opistophthalmus carinatus (African yellow leg scorpion) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Yeasts |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q5WR01, Q5WR02 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15241551 |
Physicochemical Properties
| Residues | 76 |
|---|---|
| Sequence | KWLNEKSIQNKIDEKIGKNFLGGMAKAVVHKLAKNEFMCMANMDPTGSCETHCQKASGEKGYCHGTKCKCGVPLSY |
| Molecular Weight | 8367.71 |
| Grand Average of Hydropathy | -0.554 |
| Isoelectric Point | 8.961 |
| Charge at pH 7.4 | 4.492 |
| Secondary Structure | Helix: 0.197, Turn: 0.250, Sheet: 0.237 |
| Instability Index | 23.734 |
| Aromaticity | 0.066 |