Basic Information
| ID | DRAMP18193 |
|---|
| Sequence | KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF |
|---|
| Length | 34 |
|---|
| Name | Cathelicidin-related peptide crotalicidin |
|---|
| Source | Crotalus durissus terrificus (South American rattlesnake) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | [Ref.25100358]Gram-negative: E.coli ATCC 25922 (MIC=0.25 μg/mL),P.aeruginosa (MIC=1 μg/mL);##Gram-positive: E.faecalis (MIC=32 μg/mL), S.aureus (MIC=32 μg/mL). |
|---|
| Hemolytic Activity | [Ref.25100358] Crotalicidin reached 10% hemolysis at 25 μM. Even so, extrapolation of existing data indicates that 50% hemolysis would be reached at near-millimolar values, which defines an adequate (~2 log) selectivity window. |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Amidation |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
U5KJM4 |
|---|
| PDB |
2MWT resolved by NMR |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 25100358 |
|---|
