| ID | DRAMP18202 |
|---|---|
| Sequence | LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP |
| Length | 46 |
| Name | WB Piscidin 5 (fish, animals) |
| Source | Morone chrysops |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic |
| Pathogen | Staphylococcus aureus ATCC 29213(MIC 4.52uM) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | E3UVF7(Precursor) |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 27552222 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP |
| Molecular Weight | 5536.417 |
| Grand Average of Hydropathy | -0.539 |
| Isoelectric Point | 11.842 |
| Charge at pH 7.4 | 11.613 |
| Secondary Structure | Helix: 0.370, Turn: 0.196, Sheet: 0.152 |
| Instability Index | 48.437 |
| Aromaticity | 0.174 |