| ID | DRAMP18292 |
|---|---|
| Sequence | FKKKKRNIGTFVFFAIALFCTVMFAYLLLTNQYVPIDYNVPRYA |
| Length | 44 |
| Name | LsbA(Bacteriocin) |
| Source | Lactococcus lactis |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(narrow) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O68888 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12801935 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | FKKKKRNIGTFVFFAIALFCTVMFAYLLLTNQYVPIDYNVPRYA |
| Molecular Weight | 5226.207 |
| Grand Average of Hydropathy | 0.475 |
| Isoelectric Point | 9.807 |
| Charge at pH 7.4 | 4.513 |
| Secondary Structure | Helix: 0.477, Turn: 0.136, Sheet: 0.205 |
| Instability Index | 38.707 |
| Aromaticity | 0.227 |