| ID | DRAMP18433 |
|---|---|
| Sequence | GSEIRGPCIDRFCRVICRNNGYESGHCNRWARGCSCASWIGR |
| Length | 42 |
| Name | Cremycin-15 (nematode; invertebrates, animals) |
| Source | Caenorhabditis remanei |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Active against Gram-positive bacteria B. megaterium and S. marcescens (CL 14.1-17.7 uM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 24434635 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | GSEIRGPCIDRFCRVICRNNGYESGHCNRWARGCSCASWIGR |
| Molecular Weight | 4747.351 |
| Grand Average of Hydropathy | -0.533 |
| Isoelectric Point | 8.982 |
| Charge at pH 7.4 | 3.447 |
| Secondary Structure | Helix: 0.214, Turn: 0.333, Sheet: 0.095 |
| Instability Index | 29.25 |
| Aromaticity | 0.095 |