| ID | DRAMP00093 |
|---|---|
| Sequence | FVYGNGVTSILVQAQFLVNGQRRFFYTPDK |
| Length | 30 |
| Name | Bacteriocin SRCAM 37 |
| Source | Paenibacillus polymyxa (Bacillus polymyxa) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Clostridium jejuni. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P86395 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15690798, 16977842 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | FVYGNGVTSILVQAQFLVNGQRRFFYTPDK |
| Molecular Weight | 3465.91 |
| Grand Average of Hydropathy | 0.013 |
| Isoelectric Point | 9.697 |
| Charge at pH 7.4 | 1.55 |
| Secondary Structure | Helix: 0.433, Turn: 0.233, Sheet: 0.100 |
| Instability Index | 14.337 |
| Aromaticity | 0.2 |