Basic Information
| ID | DRAMP01016 |
|---|
| Sequence | QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR |
|---|
| Length | 37 |
|---|
| Name | Antimicrobial peptide 1 (MJ-AMP1; Plant defensin) |
|---|
| Source | Mirabilis jalapa (Garden four-o'clock) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
|---|
| Pathogen | Fungi: Alternaria brassicola (MIC=20 µg/ml), Ascochyta pisi (MIC=200 µg/ml), Botrytis cinerea (MIC=50 µg/ml), Cercospora beticola (MIC=10 µg/ml), Colletotrichum lindemuthianum (MIC=6 µg/ml), Fusarium culmorum (MIC=30 µg/ml), Fusarium oxysporum f.sp.pisi (MIC=15 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=200 µg/ml), Nectria haematococca (MIC=15 µg/ml), Phoma betae (MIC=25 µg/ml), Pyrenophora tritici-repentis (MIC=300 µg/ml), Pyricularia oryzae (MIC=6 µg/ml), Rhizoctonia solani (MIC=60 µg/ml), Verticillium dahliae (MIC=12 µg/ml), Venturia inequalis (MIC=12 µg/ml).##Gram-positive bacteria: Bacillus megaterium (MIC=6 µg/ml), Sarcina lutea (MIC=100 µg/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Pyroglutamyl modification (Cyclization of a N-terminal glutamine) |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P25403 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 1733929, 7647302 |
|---|
