Basic Information
| ID | dbAMP00856 |
|---|
| Sequence | CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK |
|---|
| Length | 34 |
|---|
| Name | the yellow-spotted long-horned beetle, Psacothea hilaris&&Psacotheasin&&Psacothea hilaris |
|---|
| Source | the yellow-spotted long-horned beetle, Psacothea hilaris&&Psacothea hilaris |
|---|
| Activity | Antibacterial |
|---|
| Pathogen | Trichosporon beigelii KCTC 7707 (MIC=6.25µM)&&Staphylococcus aureus ATCC 25923 (MIC=25µM)&&RBCs Source of Human (0% hemolysis at 100µM)&&Pseudomonas aeruginosa ATCC 27853 (MIC=25µM)&&Propionibacterium acnes ATCC 6919 (MIC=12.5µM)&&Malassezia furfur KCTC 7 |
|---|
| Hemolytic Activity | Not included yet |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 20735987, 20467242, 20467242, 20467242 |
|---|
