| ID | DRAMP00383 |
|---|---|
| Sequence | AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR |
| Length | 38 |
| Name | Antimicrobial peptide 1 (Mc-AMP1; knottin-type peptide; Plant defensin) |
| Source | Mesembryanthemum crystallinum (Common ice plant) (Cryophytum crystallinum) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
| Pathogen | Gram-positive bacteria: Bacillus megaterium (IC50=2 µg/mL), Sarcina lutea (IC50=50 µg/mL).##Fungi: Alternaria brassicola (IC50=6 µg/mL), Ascochyta pisi (IC50=6 µg/mL), Botrytis cinerea (IC50=2 µg/mL), Cercospora beticola (IC50=2 µg/mL), Colletotrichum lindemuthianum (IC50=1 µg/mL), Fusarium culmorum (IC50=3 µg/mL), Fusarium oxysporum f. sp. Pisi (IC50=5 µg/mL), Fusarium oxysporum f. sp. Lycopersici (IC50=10 µg/mL), Nectria haematococca (IC50=0.5 µg/mL), Phoma betae (IC50=6 µg/mL), Pyrenophora tritici-repentis (IC50=20 µg/mL), Pyricularia oryzae (IC50=0.5 µg/mL), Rhizoctonia solani (IC50=15 µg/mL), Verticiliium dahliae (IC50=0.5 µg/mL), Venturia inaequalis (IC50=1 µg/mL). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O81338 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR |
| Molecular Weight | 4287.934 |
| Grand Average of Hydropathy | -0.832 |
| Isoelectric Point | 9.303 |
| Charge at pH 7.4 | 5.447 |
| Secondary Structure | Helix: 0.184, Turn: 0.289, Sheet: 0.079 |
| Instability Index | 5.508 |
| Aromaticity | 0.132 |