| ID | DRAMP01683 |
|---|---|
| Sequence | ALWKTLLKGAGKVFGHVAKQFLGSQGQPES |
| Length | 30 |
| Name | Dermaseptin-S11 (DS11; Frogs, amphibians, animals) |
| Source | Phyllomedusa sauvagei (Sauvage's leaf frog) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16401077 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | ALWKTLLKGAGKVFGHVAKQFLGSQGQPES |
| Molecular Weight | 3183.659 |
| Grand Average of Hydropathy | -0.167 |
| Isoelectric Point | 10.002 |
| Charge at pH 7.4 | 2.636 |
| Secondary Structure | Helix: 0.300, Turn: 0.267, Sheet: 0.267 |
| Instability Index | 33.83 |
| Aromaticity | 0.1 |
