Basic Information
| ID | DRAMP02740 |
|---|
| Sequence | YDLSKNCRLRGGICYIGKCPRRFFRSGSCSRGNVCCLRFG |
|---|
| Length | 40 |
|---|
| Name | TBD-1 (Turtle beta-defensin 1; Reptiles, animals) |
|---|
| Source | Emys orbicularis (European pond turtle) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | [Ref.19253295]Gram-negative bacterium (LS, HS): Escherichia coli ML35p (MIC=0.65, >20 µmol/L);##Gram-positive bacteria: (LS, HS): Listeria monocytogenes EGD (MIC=0.65, >20 µmol/L), Methicillin-resistant Staphylococcus aureus ATCC 33591 (MIC=5.6, >20 µmol/L).##Yeast: Candida albicans (MIC=5.2, >20 µmol/L).##NOTE: LS (low salt): 10 mmol/L sodium phosphate buffer (pH 7.4) and HS (high salt): 10 mmol/L sodium-phosphate buffer (pH 7.4), 0.1 mol/L sodium chloride. |
|---|
| Hemolytic Activity | [Ref.19253295] It has no hemolytic activity against human erythrocytes up to 25 mmol/L |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P86253 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 19253295 |
|---|
