| ID | DRAMP03118 |
|---|---|
| Sequence | RRFKKFLKKVEGAGRRVANAAQKGLPLAAGVKGLV |
| Length | 35 |
| Name | Cecropin-C (AgCecC; Insects, animals) |
| Source | Anopheles gambiae (African malaria mosquito) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8MUF3, B2FVD8, Q7QEE4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12421409 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | RRFKKFLKKVEGAGRRVANAAQKGLPLAAGVKGLV |
| Molecular Weight | 3735.479 |
| Grand Average of Hydropathy | -0.203 |
| Isoelectric Point | 12 |
| Charge at pH 7.4 | 8.543 |
| Secondary Structure | Helix: 0.286, Turn: 0.200, Sheet: 0.314 |
| Instability Index | 30.703 |
| Aromaticity | 0.057 |