| ID | DRAMP03396 |
|---|---|
| Sequence | RSHIDIKNGIERCEKVRGMCKTVCDIDEYDYGYCIRWRNQCCI |
| Length | 43 |
| Name | Beta-defensin 41 (BD-41, mBD-41; Defensin, beta 41; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8C1G4, Q4FZ55 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 16023745 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | RSHIDIKNGIERCEKVRGMCKTVCDIDEYDYGYCIRWRNQCCI |
| Molecular Weight | 5186.952 |
| Grand Average of Hydropathy | -0.642 |
| Isoelectric Point | 7.769 |
| Charge at pH 7.4 | 0.437 |
| Secondary Structure | Helix: 0.279, Turn: 0.140, Sheet: 0.093 |
| Instability Index | 47.751 |
| Aromaticity | 0.093 |