| ID | DRAMP04259 |
|---|---|
| Sequence | DKLIGSCVWGAVNYTSDCNGECLLRGYKGGYCSGFANVNCWCET |
| Length | 44 |
| Name | LL |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11580275 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | DKLIGSCVWGAVNYTSDCNGECLLRGYKGGYCSGFANVNCWCET |
| Molecular Weight | 4758.307 |
| Grand Average of Hydropathy | -0.061 |
| Isoelectric Point | 4.783 |
| Charge at pH 7.4 | -1.599 |
| Secondary Structure | Helix: 0.295, Turn: 0.318, Sheet: 0.159 |
| Instability Index | 18.818 |
| Aromaticity | 0.136 |