| ID | DRAMP18317 |
|---|---|
| Sequence | MGAVIKVGAKVIGWGAASGAGLYGLEKILKK |
| Length | 31 |
| Name | Aureocin A70 (AurD)(Bacteriocin) |
| Source | Staphylococcus aureus A70 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q93GF8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11531330 |
Physicochemical Properties
| Residues | 31 |
|---|---|
| Sequence | MGAVIKVGAKVIGWGAASGAGLYGLEKILKK |
| Molecular Weight | 3086.734 |
| Grand Average of Hydropathy | 0.632 |
| Isoelectric Point | 10 |
| Charge at pH 7.4 | 3.271 |
| Secondary Structure | Helix: 0.355, Turn: 0.258, Sheet: 0.323 |
| Instability Index | -13.6 |
| Aromaticity | 0.065 |