Basic Information
| ID | DRAMP01521 |
| Sequence | SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC |
| Length | 33 |
| Name | Rugosin-B (Frogs, amphibians, animals) |
| Source | Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus 209P (MIC=6.25 µg/ml), Bacillus subtilis ATCC6633 (MIC=6.25 µg/ml), Micrococcus luteus ATCC9341 (MIC=1.56 µg/ml), Streptococcus pyogenes COOK (MIC=12.5 µg/ml);##Gram-negative bacteria: Escherichia coli NIHJ (MIC=12.5 µg/ml), Pseudomonas aeruginosa PAO-1 (MIC=100 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | [Ref.7612013]No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Cyclization (Cys27 and Cys33) |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot |
P80955 |
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 7612013 |
|---|