| ID | dbAMP00812 |
|---|---|
| Sequence | CGESCVFIPCISTLLGCSCKNKVCYRNGVIP |
| Length | 31 |
| Name | Circulin B&&Chassalia parviflora |
| Source | Chassalia parviflora |
| Activity | Antibacterial |
| Pathogen | RBCs Source of Human (HD50 =30µM)&&RBCs Source of Human (50% hemolysis at ~20µM) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P56879 |
| PDB | 2ERI |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10600388, 10441158 |
Physicochemical Properties
| Residues | 31 |
|---|---|
| Sequence | CGESCVFIPCISTLLGCSCKNKVCYRNGVIP |
| Molecular Weight | 3307.97 |
| Grand Average of Hydropathy | 0.642 |
| Isoelectric Point | 8.334 |
| Charge at pH 7.4 | 1.404 |
| Secondary Structure | Helix: 0.323, Turn: 0.323, Sheet: 0.097 |
| Instability Index | 26.345 |
| Aromaticity | 0.065 |