| ID | dbAMP00815 |
|---|---|
| Sequence | CGESCVWIPCISAALGCSCKNKVCYRNGIP |
| Length | 30 |
| Name | Circulin A |
| Source | |
| Activity | Antibacterial |
| Pathogen | RBCs Source of Human (50% hemolysis at ~20µM) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P56871 |
| PDB | 1BH4 |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10600388, 9878410 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | CGESCVWIPCISAALGCSCKNKVCYRNGIP |
| Molecular Weight | 3175.77 |
| Grand Average of Hydropathy | 0.417 |
| Isoelectric Point | 8.334 |
| Charge at pH 7.4 | 1.404 |
| Secondary Structure | Helix: 0.267, Turn: 0.333, Sheet: 0.133 |
| Instability Index | 24.06 |
| Aromaticity | 0.067 |