| ID | dbAMP03680 |
|---|---|
| Sequence | GLMSLFKGVLKTAGKHIFKNVGGSLLDQAKCKITGEC |
| Length | 37 |
| Name | the Hokkaido frog, Rana pirica, Asia&&Brevinin-2PRadata about MIC or HC50 is present&&Brevinin-2PRa |
| Source | the Hokkaido frog, Rana pirica, Asia |
| Activity | Antibacterial |
| Pathogen | Staphylococcus aureus NCTC 8325 (MIC=25µM)&&RBCs Source of Human (HC50 =55µM)&&Pseudomonas aeruginosa ATCC 27853 (MIC=3µM)&&Pseudomonas aeruginosa 87104 (MIC=6µM)&&Pseudomonas aeruginosa 78905 (MIC=12µM)&&Pseudomonas aeruginosa 78888 (MIC=12µM)&&Pseudomon |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15003829, 15003829 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | GLMSLFKGVLKTAGKHIFKNVGGSLLDQAKCKITGEC |
| Molecular Weight | 3893.642 |
| Grand Average of Hydropathy | 0.176 |
| Isoelectric Point | 9.514 |
| Charge at pH 7.4 | 3.532 |
| Secondary Structure | Helix: 0.297, Turn: 0.243, Sheet: 0.243 |
| Instability Index | 24.762 |
| Aromaticity | 0.054 |