Basic Information
| ID | DRAMP01018 |
|---|
| Sequence | SIPCGESCVFIPCTVTALLGCSCKSKVCYKN |
|---|
| Length | 31 |
|---|
| Name | Cyclopsychotride-A (CPT; Plant defensin) |
|---|
| Source | Psychotria longipes |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli (MIC=1.55 µM), Pseudomonas aeruginosa (MIC=13.5 µM), Proteus vulgaris (MIC=13.2 µM), Klebsiella oxytoca (MIC=5.80 µM).##Gram-positive bacteria: Staphylococcus aureus (MIC=39.0 µM), Micrococcus luteus (MIC=48.0 µM).##Fungi: Candida albicans (MIC>500 µM), Candida kefyr (MIC=14.0 µM), Candida tropicalis (MIC=56.5 µM).##NOTE: Medium with 10 mM phosphate buffer. |
|---|
| Hemolytic Activity | [Ref.10430870] HD50 = 405 μM against blood type A human erythrocytes. |
|---|
| Cytotoxicity | [Ref.10430870] It caused 50% cell growth inhibition of mouse fibroblasts at 1850 μM. |
|---|
| N-terminal Modification | Cyclization (N termini to C termini) |
|---|
| C-terminal Modification | Cyclization (C termini to N termini) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P56872 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10430870, 7714530 |
|---|
