| ID | DRAMP01522 |
|---|---|
| Sequence | GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC |
| Length | 37 |
| Name | Rugosin-C (Frogs, amphibians, animals) |
| Source | Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Staphylococcus aureus 209P. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80956 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7612013 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC |
| Molecular Weight | 3815.527 |
| Grand Average of Hydropathy | 0.246 |
| Isoelectric Point | 9.514 |
| Charge at pH 7.4 | 3.494 |
| Secondary Structure | Helix: 0.270, Turn: 0.216, Sheet: 0.243 |
| Instability Index | 22.759 |
| Aromaticity | 0.054 |