| ID | DRAMP02594 |
|---|---|
| Sequence | GWFGKAFRSVSNFYKKHKTYIHAGLSAATLL |
| Length | 31 |
| Name | Styelin-C (Styelin C; chordates, animals) |
| Source | Styela clava (Sea squirt) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O18494 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9257708 |
Physicochemical Properties
| Residues | 31 |
|---|---|
| Sequence | GWFGKAFRSVSNFYKKHKTYIHAGLSAATLL |
| Molecular Weight | 3500.016 |
| Grand Average of Hydropathy | -0.09 |
| Isoelectric Point | 10.295 |
| Charge at pH 7.4 | 4.616 |
| Secondary Structure | Helix: 0.355, Turn: 0.226, Sheet: 0.226 |
| Instability Index | 42.381 |
| Aromaticity | 0.194 |