| ID | DRAMP03283 |
|---|---|
| Sequence | LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA |
| Length | 36 |
| Name | Turkey Heterophil Peptide 2 (Antimicrobial peptide THP2, THP2; Birds, animals) |
| Source | Meleagris gallopavo (Common turkey) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Staphylococcus aureus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80392 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7964174, 19151352 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA |
| Molecular Weight | 4134.881 |
| Grand Average of Hydropathy | -0.014 |
| Isoelectric Point | 9.182 |
| Charge at pH 7.4 | 4.477 |
| Secondary Structure | Helix: 0.278, Turn: 0.250, Sheet: 0.083 |
| Instability Index | 53.378 |
| Aromaticity | 0.167 |