| ID | DRAMP03651 |
|---|---|
| Sequence | IATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY |
| Length | 38 |
| Name | Gallinacin-3 (Gal-3; Beta-defensin 3; Birds, animals) |
| Source | Gallus gallus (Chicken) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9DG58, Q0PWH2, Q6GXJ2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11254635, 15148642, 16394622 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | IATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY |
| Molecular Weight | 4123.901 |
| Grand Average of Hydropathy | 0.429 |
| Isoelectric Point | 9.487 |
| Charge at pH 7.4 | 5.442 |
| Secondary Structure | Helix: 0.263, Turn: 0.211, Sheet: 0.105 |
| Instability Index | 39.35 |
| Aromaticity | 0.105 |