| ID | DRAMP03660 |
|---|---|
| Sequence | HGPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT |
| Length | 46 |
| Name | Gallinacin-12 (Gal-12; Beta-defensin 12; Birds, animals) |
| Source | Gallus gallus (Chicken) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q6QLQ7, A0MV42, Q0PWG3, Q6IV19 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17244739, 15310403 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | HGPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT |
| Molecular Weight | 5035.761 |
| Grand Average of Hydropathy | -0.465 |
| Isoelectric Point | 7.784 |
| Charge at pH 7.4 | 0.474 |
| Secondary Structure | Helix: 0.217, Turn: 0.326, Sheet: 0.152 |
| Instability Index | 27.57 |
| Aromaticity | 0.065 |
