| ID | DRAMP03711 |
|---|---|
| Sequence | GLIHKVTKVQQLCAFNQDMAGWCEKSCQAAEGKNGYCHGTKCKCGKPLSYRRK |
| Length | 53 |
| Name | Scorpine-like peptide (OcyC7; Arthropods, animals) |
| Source | Opisthacanthus cayaporum (South American scorpion) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | C5J891 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19379768 |
Physicochemical Properties
| Residues | 53 |
|---|---|
| Sequence | GLIHKVTKVQQLCAFNQDMAGWCEKSCQAAEGKNGYCHGTKCKCGKPLSYRRK |
| Molecular Weight | 5904.854 |
| Grand Average of Hydropathy | -0.706 |
| Isoelectric Point | 9.355 |
| Charge at pH 7.4 | 6.461 |
| Secondary Structure | Helix: 0.189, Turn: 0.208, Sheet: 0.189 |
| Instability Index | 28.177 |
| Aromaticity | 0.075 |