| ID | DRAMP03830 |
|---|---|
| Sequence | GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVEYHK |
| Length | 39 |
| Name | Palustrin-2ISb + 3aa |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli (MIC=6.3 µM);##Gram-positive bacteria: Staphylococcus aureus (MIC=6.3 µM), S. aureus (MRSA) (MIC=100 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21911019 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVEYHK |
| Molecular Weight | 4317.087 |
| Grand Average of Hydropathy | -0.182 |
| Isoelectric Point | 9.628 |
| Charge at pH 7.4 | 4.527 |
| Secondary Structure | Helix: 0.333, Turn: 0.231, Sheet: 0.154 |
| Instability Index | 25.474 |
| Aromaticity | 0.077 |