| ID | DRAMP18281 |
|---|---|
| Sequence | GRADYNFGYGLGRGTRKFFNGIGRWVRKTF |
| Length | 30 |
| Name | Plantaricin KL-1Y (Bacteriocin) |
| Source | Lactobacillus plantarum KL-1 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive, Gram-negative (broad-spectrum) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 25862353 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | GRADYNFGYGLGRGTRKFFNGIGRWVRKTF |
| Molecular Weight | 3497.924 |
| Grand Average of Hydropathy | -0.767 |
| Isoelectric Point | 11.466 |
| Charge at pH 7.4 | 5.548 |
| Secondary Structure | Helix: 0.333, Turn: 0.300, Sheet: 0.067 |
| Instability Index | 3.043 |
| Aromaticity | 0.233 |