| ID | DRAMP18290 |
|---|---|
| Sequence | IGGALGNALNGLGTWANMMNGGGFVNQWQVYANKGKINQYRPY |
| Length | 43 |
| Name | Garvicin A (Bacteriocin) |
| Source | Lactococcus garvieae 21881 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(certain) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 23666326 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | IGGALGNALNGLGTWANMMNGGGFVNQWQVYANKGKINQYRPY |
| Molecular Weight | 4645.199 |
| Grand Average of Hydropathy | -0.379 |
| Isoelectric Point | 9.823 |
| Charge at pH 7.4 | 2.545 |
| Secondary Structure | Helix: 0.302, Turn: 0.395, Sheet: 0.209 |
| Instability Index | -5.328 |
| Aromaticity | 0.14 |