| ID | DRAMP18373 |
|---|---|
| Sequence | CMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK |
| Length | 33 |
| Name | mBD-6 (Murine beta-defensin 6) |
| Source | Mus musculus |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacteria: E. coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11408484 |
Physicochemical Properties
| Residues | 33 |
|---|---|
| Sequence | CMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK |
| Molecular Weight | 3616.221 |
| Grand Average of Hydropathy | -0.721 |
| Isoelectric Point | 9.694 |
| Charge at pH 7.4 | 6.476 |
| Secondary Structure | Helix: 0.121, Turn: 0.364, Sheet: 0.061 |
| Instability Index | 81.682 |
| Aromaticity | 0.061 |