| ID | DRAMP01690 |
|---|---|
| Sequence | GMWSTIRNVGKSAAKAANLPAKAALGAISEAV |
| Length | 32 |
| Name | Dermaseptin AA-3-6 (Frogs, amphibians, animals) |
| Source | Agalychnis annae (Blue-sided leaf frog) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O93226 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9774745 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | GMWSTIRNVGKSAAKAANLPAKAALGAISEAV |
| Molecular Weight | 3154.641 |
| Grand Average of Hydropathy | 0.3 |
| Isoelectric Point | 10.29 |
| Charge at pH 7.4 | 2.551 |
| Secondary Structure | Helix: 0.219, Turn: 0.281, Sheet: 0.406 |
| Instability Index | 23.641 |
| Aromaticity | 0.031 |
