Basic Information
| ID | DRAMP21453 |
|---|
| Sequence | GLPLLISWIKRKRQQGSKKPVPIIYCNRRTGKCQRM |
|---|
| Length | 36 |
|---|
| Name | Hybrid (Derived from Melittin and thanatin) |
|---|
| Source | synthetic construct |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | [Ref.30701481] Gram-positive bacteria:Staphylococcus aureus(MIC=0.9-1.5μmol/L), Bacillus subtilis(MIC=0.6-1.2μmol/L);##Gram-negative bacteria:Escherichia coli JM 109(MIC=0.6-1.2 μmol/L), Salmonella typhimurium(MIC=0.3-0.6μmol/L) |
|---|
| Hemolytic Activity | [Ref.30701481] 0% hemolysis at 45 μmol/L and >0% hemolysis at 60 μmol/L against sheep blood cells |
|---|
| Cytotoxicity | [Ref.30701481] The average inhibitory rate of the hybrid peptide in the SMMC-7721 cells was 19.14%. |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Linear |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 30701481 |
|---|
