| ID | dbAMP10167 |
|---|---|
| Sequence | QLGELIQQGGQKIVEKIQKIGQRIRDFFSNLRPRQEA |
| Length | 37 |
| Name | the bone marrow, Felis catus&&FeCath &&Cathelicidin, FeCath |
| Source | the bone marrow, Felis catus |
| Activity | Antibacterial |
| Pathogen | Staphylococcus pseudintermedius (MIC=11µg/ml)&&Salmonella enterica serovar Typhimurium IR715 (MIC=29µg/ml)&&Listeria monocytogenes (MIC=12µg/ml)&&Escherichia coli D31 (MIC=21µg/ml) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21533281 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | QLGELIQQGGQKIVEKIQKIGQRIRDFFSNLRPRQEA |
| Molecular Weight | 4322.926 |
| Grand Average of Hydropathy | -0.816 |
| Isoelectric Point | 10.257 |
| Charge at pH 7.4 | 2.554 |
| Secondary Structure | Helix: 0.297, Turn: 0.189, Sheet: 0.189 |
| Instability Index | 23.8 |
| Aromaticity | 0.054 |