Total records: 4872, Total pages: 195
| ID | Name | Sequence | PubMed ID |
|---|---|---|---|
| DRAMP03776 | UyCT3 (Arthropods, animals) | ILSAIWSGIKSLF | 23182832 |
| DRAMP03777 | UyCT5 (Arthropods, animals) | IWSAIWSGIKGLL | 23182832 |
| DRAMP03797 | CAP7 (C-terminal fragment of CAP18; lagomorphs, mammals, animals) | GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY | 8132348 10768969 7649303 |
| DRAMP03814 | D16W (GGN4 analogue peptide with single substitution) | GILDTLKQFAKGVGKWLVKGAAQGVLSTVSCKLAKTC | 12199716 |
| DRAMP03815 | D16W-N23 (single amino acid substitution) | GILDTLKQFAKGVGKWLVKGAAQ | 12199716 |
| DRAMP03816 | D16F-N23 (single amino acid substitution) | GILDTLKQFAKGVGKFLVKGAAQ | 12199716 |
| DRAMP03823 | Dermaseptin derivative K4-S4-(1-13) | ALWKTLLKKVLKA | 16407175 15917541 |
| DRAMP03824 | CNBr-cleaved lactoferricin Subfragment 1 | FKCRRWQWR | 8980754 |
| DRAMP03825 | CNBr-cleaved lactoferricin Subfragment 2 | KKLGAPSITCVRRAFA | 8980754 |
| DRAMP03826 | Ovispirin-1 (OV-1; N-terminal 18 amino acids of SMAP-29) | KNLRRIIRKIIHIIKKYG | 11932493 |
| DRAMP03827 | Novispirin G-10 (mutation of Ovispirin-1) | KNLRRIIRKGIHIIKKYG | 11932493 |
| DRAMP03828 | Novispirin T-7 (mutation of Ovispirin-1) | KNLRRITRKIIHIIKKYG | 11932493 |
| DRAMP03829 | GLK-19 | GLKKLLGKLLKKLGKLLLK | 18957441 |
| DRAMP03830 | Palustrin-2ISb + 3aa | GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVEYHK | 21911019 |
| DRAMP03831 | Palustrin-2ISb-des-C7 | GLWNSIKIAGKKLFVNVLDKIRCKVAGGC | 21911019 |
| DRAMP03832 | Palustrin-2ISb-des-C7-4D | GLWDSIKIAGKKLFVNVLDKIRCKVAGGC | 21911019 |
| DRAMP03833 | Palustrin-2ISb-des-C7-12N | GLWNSIKIAGKNLFVNVLDKIRCKVAGGC | 21911019 |
| DRAMP03834 | Palustrin-2ISb-des-C7-23,29S | GLWNSIKIAGKKLFVNVLDKIRSKVAGGS | 21911019 |
| DRAMP03852 | G1 (Bac2A variant through single amino acid substitution) | GLARIVVIRVAR | 16041366 |
| DRAMP03853 | G2 (Bac2A variant through single amino acid substitution) | RGARIVVIRVAR | 16041366 |
| DRAMP03854 | R2 (Bac2A variant through single amino acid substitution) | RRARIVVIRVAR | 16041366 |
| DRAMP03855 | R3 (Bac2A variant through single amino acid substitution) | RLRRIVVIRVAR | 16041366 |
| DRAMP03856 | W3 (Bac2A variant through single amino acid substitution) | RLWRIVVIRVAR | 16041366 |
| DRAMP03857 | R5 (Bac2A variant through single amino acid substitution) | RLARRVVIRVAR | 16041366 |
| DRAMP03858 | K7 (Bac2A variant through single amino acid substitution) | RLARIVKIRVAR | 16041366 |