Total records: 4872, Total pages: 195
| ID | Name | Sequence | PubMed ID |
|---|---|---|---|
| DRAMP21247 | PV (Derived from pEM-2 and MP-VT1) | KKWRWWLKALAKKLL | 27591703 |
| DRAMP21248 | BVP (Derived from pEM-2 and MP-VT1 and MP-B) | LKLKAIAALAKKKW | 27591703 |
| DRAMP21249 | PVP (Derived from MP-B and MP-VT1) | KKWRKLLKWLAKK | 27591703 |
| DRAMP21250 | PV3 (Derived from pEM-2 and MP-VT1) | KKWRKLLKKLKKLL | 27591703 |
| DRAMP21251 | AaeAP1 (Scorpionida, Arachricla, Arthropoda) | FLFSLIPSVIAGLVSAIRN | 25626077 |
| DRAMP21252 | AaeAP2 (Scorpionida, Arachricla, Arthropoda) | FLFSLIPSAIAGLVSAIRN | 25626077 |
| DRAMP21253 | AaeAP1a (Derived from AaeAP1) | FLFKLIPKAIKGLVKAIRK | 25626077 |
| DRAMP21254 | AaeAP2a (Derived from AaeAP2) | FLFKLIPKVIKGLVKAIRK | 25626077 |
| DRAMP21255 | WL1 (Derived from CP-1) | WLSKTAKKL | 29266746 |
| DRAMP21256 | WL2 (Derived from CP-1) | WLSKTAKKLWLSKTAKKL | 29266746 |
| DRAMP21257 | WL3 (Derived from CP-1) | WLSKTAKKLWLSKTAKKLWLSKTAKKL | 29266746 |
| DRAMP21259 | Scolopendin 1 (Centipedes, Arthropoda, Animals) | MDSFQKIEKIGEGTYGVVYKAKDKVSGRLVALKKIRLENESEGVPSTA | 25209888 |
| DRAMP21260 | KL0A10 (De novo synthesis) | AAKAAAKAAAKAA | 26385363 |
| DRAMP21261 | KL4A6 (De novo synthesis) | LLKAAAKAAAKLL | 26385363 |
| DRAMP21262 | KL6A4 (De novo synthesis) | AAKLLLKLLLKAA | 26385363 |
| DRAMP21263 | KL10A0 (De novo synthesis) | LLKLLLKLLLKLL | 26385363 |
| DRAMP21264 | LK (De novo synthesis) | LKKLLKLLKKLLKLAG | 23894079 |
| DRAMP21265 | LK-L1A (Derived from LK) | AKKLLKLLKKLLKLAG | 23894079 |
| DRAMP21266 | LK-L4A (Derived from LK) | LKKALKLLKKLLKLAG | 23894079 |
| DRAMP21267 | LK-L5A (Derived from LK) | LKKLAKLLKKLLKLAG | 23894079 |
| DRAMP21268 | LK-L7A (Derived from LK) | LKKLLKALKKLLKLAG | 23894079 |
| DRAMP21269 | LK-L8A (Derived from LK) | LKKLLKLAKKLLKLAG | 23894079 |
| DRAMP21270 | LK-L11A (Derived from LK) | LKKLLKLLKKALKLAG | 23894079 |
| DRAMP21271 | LK-L12A (Derived from LK) | LKKLLKLLKKLAKLAG | 23894079 |
| DRAMP21272 | LK-L14A (Derived from LK) | LKKLLKLLKKLLKAAG | 23894079 |