Total records: 4872, Total pages: 195
| ID | Name | Sequence | PubMed ID |
|---|---|---|---|
| DRAMP03912 | LFM R1,9 W8 Y13 (LFM W8 derivative with residues substitution) | RKCLRWQWRMRKYGG | 11168896 |
| DRAMP03920 | Cecropin A (1-8)-melittin (1-13)hybrid peptide | KWKLFKKIEKVGQGIGAVLKVLTTGL | 1733777 |
| DRAMP03921 | Cecropin A (1-8)-melittin (1-18)hybrid peptide | KWKLFKKIGIGAVLKVLTTGLPALIS | 1733777 |
| DRAMP03922 | Cecropin A (1-8)-melittin (1-12)hybrid peptide | KWKLFKKIGIGAVLKVLTTG | 1733777 |
| DRAMP03923 | Cecropin A (1-8)-melittin (1-10)hybrid peptide | KWKLFKKIGIGAVLKVLT | 1733777 |
| DRAMP03924 | Cecropin A (1-7)-melittin (1-8)hybrid peptide | KWKLFKKGIGAVLKV | 1733777 |
| DRAMP03925 | Cecropin A (1-7)-melittin (3-10)hybrid peptide | KWKLFKKGAVLKVLT | 1733777 |
| DRAMP03927 | Cecropin A (1-7)-melittin (2-9)hybrid peptide | KWKLFKKIGAVLKVL | 1733777 17397158 |
| DRAMP03928 | Cecropin A (1-7)-melittin (4-11)hybrid peptide (CAM) | KWKLFKKAVLKVLTT | 1733777 20111863 |
| DRAMP03929 | Cecropin A (1-7)-melittin (5-12)hybrid peptide | KWKLFKKVLKVLTTG | 1733777 |
| DRAMP03930 | Cecropin A (1-7)-melittin (6-13)hybrid peptide | KWKLFKKLKVLTTGL | 1733777 |
| DRAMP03931 | hPAB-beta (a hBD-2 variant; beta-defensins) | DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPN | 15808901 |
| DRAMP03933 | I14M (truncated isoform of thanatin, residue 8-21) | IIYCNRRTGKCQRM | 8577744 |
| DRAMP03934 | Y12M (truncated isoform of thanatin, residue 10-21) | YCNRRTGKCQRM | 8577744 |
| DRAMP03935 | V16M (truncated isoform of thanatin, residue 6-21) | VPIIYCNRRTGKCQRM | 8577744 |
| DRAMP03936 | K18M (truncated isoform of thanatin, residue 4-21) | KPVPIIYCNRRTGKCQRM | 8577744 |
| DRAMP03937 | G18C (truncated isoform of thanatin, residue 1-18) | GSKKPVPIIYCNRRTGKC | 8577744 |
| DRAMP03938 | G19Q (truncated isoform of thanatin, residue 1-19) | GSKKPVPIIYCNRRTGKCQ | 8577744 |
| DRAMP03939 | G20R (truncated isoform of thanatin, residue 1-20) | GSKKPVPIIYCNRRTGKCQR | 8577744 |
| DRAMP03945 | Del 1-4 (Ranalexin analog) | LIKIVPAMICAVTKKC | 8144672 |
| DRAMP03947 | Del 1-2 (Ranalexin analog) | GGLIKIVPAMICAVTKKC | 8144672 |
| DRAMP03948 | Del 1 (Ranalexin analog) | LGGLIKIVPAMICAVTKKC | 8144672 |
| DRAMP03949 | Del 20 (Ranalexin analog) | FLGGLIKIVPAMICAVTKK | 8144672 |
| DRAMP03955 | Human recombinant Ser-Thr-Ala-CGA1-78 peptide (hrVS-1) | STALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKK | 10753865 |
| DRAMP03967 | P18 (Cecropin A(1-8)-Magainin 2(1−12) hybrid peptide analogue) | KWKLFKKIPKFLHLAKKF | 12005420 12370027 |