Total records: 4872, Total pages: 195
| ID | Name | Sequence | PubMed ID |
|---|---|---|---|
| DRAMP04026 | K12 (single amino acid substitution of Bac034, which is a scrambled Variant of Bac2A) | VRLRIRVAVIRK | 17052614 |
| DRAMP04027 | opt1 (multiple amino acid substitution of Bac034, which is a scrambled Variant of Bac2A) | VQLRIRVRVIRK | 17052614 |
| DRAMP04028 | opt2 (multiple amino acid substitution of Bac034, which is a scrambled Variant of Bac2A) | VRLRIRVRVIRK | 17052614 |
| DRAMP04029 | opt3 (multiple amino acid substitution of Bac034, which is a scrambled Variant of Bac2A) | KQFRIRVRVIRK | 17052614 |
| DRAMP04030 | opt4 (multiple amino acid substitution of Bac034, which is a scrambled Variant of Bac2A) | KRFRIRVRVIRK | 17052614 |
| DRAMP04031 | opt5 (multiple amino acid substitution of Bac034, which is a scrambled Variant of Bac2A) | KRWRIRVRVIRK | 17052614 |
| DRAMP04032 | Modified defensin | ALRLAIRKR | 10561605 |
| DRAMP04033 | Modified defensin | ALLLAIRKR | 10561605 |
| DRAMP04034 | Modified defensin | AWLLAIRKR | 10561605 |
| DRAMP04035 | Modified defensin | ALYLAIRKR | 10561605 |
| DRAMP04036 | Modified defensin | ALWLAIRKR | 10561605 |
| DRAMP04048 | BacR (cyclic derivative of bactenecin) | RRLCRIVVIRVCRR | 10223951 |
| DRAMP04049 | BacP3R (cyclic derivative of bactenecin) | RRRCPIVVIRVCRR | 10223951 |
| DRAMP04050 | BacP3R-V (cyclic derivative of bactenecin) | RRRLCPIVIRVCRR | 10223951 |
| DRAMP04051 | Bac2I-NH2 (cyclic derivative of bactenecin) | RICRIVVIRCIR | 10223951 |
| DRAMP04052 | BacP2R-NH2 (cyclic derivative of bactenecin) | RLCPRVRIRVCR | 10223951 |
| DRAMP04053 | BacP1 (cyclic derivative of bactenecin) | RLCRIVPVIRVCR | 10223951 |
| DRAMP04054 | BacW (cyclic derivative of bactenecin) | RLCRIVWVIRVCR | 10223951 |
| DRAMP04055 | BacW2R (cyclic derivative of bactenecin) | RRLCRIVWVIRVCRR | 10223951 |
| DRAMP04056 | Lin Bac2S-NH2 (linear derivative of bactenecin) | RLSRIVVIRVSR | 10223951 |
| DRAMP04057 | Lin BacS-NH2 (linear derivative of bactenecin) | RLSRIVVIRVCR | 10223951 |
| DRAMP18364 | Thuricin 4A-4 (bacteriocin) | WTTIVKVSKAVCKTGTCICTTSCSNCK | 25548056 |
| DRAMP18365 | Thusin (ThsA1, ThsA2; a two-chain lantibiotic, type 2, class 1 bacteriocins) | INTWNTTATSTSIIISETFGNKGKVCTYTVECVNNCRG | 27486447 |
| DRAMP18363 | Sviceucin (bacteriocin) | CVWGGDCTDFLGCGTAWICV | 26343290 |
| DRAMP18361 | YD1 (bacteriocin) | APKGVQGPNG | 28050849 |